PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29889.m003284
Common NameRCOM_1000320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 562aa    MW: 64012.8 Da    PI: 5.5131
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29889.m003284genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS292.11.5e-891935601374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                    lvelLl+ Ae v  +++e+a++lL++ + l+s+ g+p+qR++ +f eAL++r+ r++ +  ++   +++++ +  ++ aa  + ++  P+++++ +
  29889.m003284 193 LVELLLASAEKVGYQQFERASRLLNHCELLSSNIGNPVQRVVYHFSEALKERIDRETGRFPSIEYLRKKQPVD-PNHNAASLACHQKIPFIQVARF 287
                    689****************************************************555555444444444333.33334444588999******** PP

           GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                    ta q I+e v++++r+HiiD++i  G+QWp L+qaL sR   +   l+i ++g    +sk+ +e tg+rLa+fAe+++vpf+f++++++++ dl+ 
  29889.m003284 288 TAIQEIVENVARAKRIHIIDLEIRSGAQWPVLMQALMSRHhCPLELLKISAIGT---TSKHLIEDTGKRLASFAESMNVPFSFRAVMVSDMLDLKK 380
                    ****************************************445569********...6899*********************************** PP

           GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                    e ++++++Ea+aV + + l++ll  +  les    ++ ++++++P+v+vv+e ea+ ns+sF++rf+eal +ysa fd+++a + r++ +r+  E 
  29889.m003284 381 ELFELDSEEAVAVYSEYFLMNLLVAPNRLES----IMGMLRNINPNVMVVMEVEANNNSPSFVHRFIEALFFYSAYFDCFDACMERDDPNRMAAES 472
                    ***********************77777777....************************************************************* PP

           GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    ++++  i+n+va eg+err rh +   Wr+ + ++G+ + +ls++   qa+l+l+k++ +   +++ +++sl + Wk  p+ s+S+W+
  29889.m003284 473 VFFHHGIRNIVASEGEERRIRHVKIDVWRSFFARFGMIQTELSTSSLYQASLVLKKFPcGSSCTLDVNEKSLNISWKATPISSLSVWK 560
                    **********************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.847167539IPR005202Transcription factor GRAS
PfamPF035145.3E-87193560IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MASDAMFSFD DFNFVASQDE LSCTPVDGAN MRKKTCVYGA DECEEFNGSG YGFYQAVTFQ  60
EGLLFSKYQQ QEHKSEQYLN YEEIEKLDDE IPSGIQHISE SKTEIQNQNQ NQTCFSFASL  120
ELLKKYDNGR INGGRIVKPG SSRGLSTEEV IRIAGARFIQ SCWQAVDITS MLHNPFGLFF  180
SDLSDDESRN VELVELLLAS AEKVGYQQFE RASRLLNHCE LLSSNIGNPV QRVVYHFSEA  240
LKERIDRETG RFPSIEYLRK KQPVDPNHNA ASLACHQKIP FIQVARFTAI QEIVENVARA  300
KRIHIIDLEI RSGAQWPVLM QALMSRHHCP LELLKISAIG TTSKHLIEDT GKRLASFAES  360
MNVPFSFRAV MVSDMLDLKK ELFELDSEEA VAVYSEYFLM NLLVAPNRLE SIMGMLRNIN  420
PNVMVVMEVE ANNNSPSFVH RFIEALFFYS AYFDCFDACM ERDDPNRMAA ESVFFHHGIR  480
NIVASEGEER RIRHVKIDVW RSFFARFGMI QTELSTSSLY QASLVLKKFP CGSSCTLDVN  540
EKSLNISWKA TPISSLSVWK FI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3522356033375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015574674.10.0PREDICTED: DELLA protein RGL1
TrEMBLB9RZP40.0B9RZP4_RICCO; DELLA protein RGL1, putative
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.18e-46RGA-like 1